PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 375aa    MW: 39792.3 Da    PI: 7.291
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042200genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+ +W+++++  g+ R+ k+c++rw +yl
      Lus10042200 14 KGPWTPEEDITLVSYIQEHGPSNWRSVPSNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.69e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Lus10042200  67 RGNFTPHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.406961IPR017930Myb domain
SuperFamilySSF466893.59E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-231568IPR009057Homeodomain-like
CDDcd001675.39E-111661No hitNo description
PROSITE profilePS5129423.84962116IPR017930Myb domain
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PfamPF002492.4E-1467112IPR001005SANT/Myb domain
CDDcd001675.18E-1169111No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2569117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDITLVSYIQ EHGPSNWRSV PSNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLH  120
DGGGEGGDGG AGSSPSAAGS PQTKGQWERR LQTDIGLAKQ ALCEALSLDK PIPTDDSSAA  180
PAAVVMESKP SISTSPSSGS GATTIISNAA SYASSTDNIA RLLQNWMRKP THHDHIQMQT  240
NSGTTQNSVA AAAAANSGSS GGGSHNSYFD SLFGFNSSPS DGGTSQSVEV AAAIFQDESK  300
PMIIRQRRGN CINDINAATG ETVSPPAPAL SLLERWLFDE STAAAVAAHA SAGDVVDLMN  360
ISSLDGTVSE FEMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-26141164105C-Myb DNA-Binding Domain
1msf_C3e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209276.11e-127hypothetical protein PRUPE_ppa007562mg
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLM5WUN21e-127M5WUN2_PRUPE; Uncharacterized protein
STRINGSolyc03g116100.2.11e-115(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-95myb domain protein 94